SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000000453 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000000453
Domain Number 1 Region: 19-147
Classification Level Classification E-value
Superfamily Lysozyme-like 1.37e-53
Family C-type lysozyme 0.000000649
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000000453   Gene: ENSTBEG00000000536   Transcript: ENSTBET00000000522
Sequence length 148
Comment pep:novel scaffold:TREESHREW:scaffold_116195:26997:32126:1 gene:ENSTBEG00000000536 transcript:ENSTBET00000000522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALLVLGLLLLSVTVQGKIYERCELARTMKRFGLDGFAGISLANWMCLAKWESDYDTRA
TNYNPGDRSTDYGIFQINSRYWCNDGKTPRAVNACGISCNALLQDDISQAAACAKRVVKD
PQGVRAWVAWRNRCQNQDVSQYVRGCGV
Download sequence
Identical sequences ENSTBEP00000000453 ENSTBEP00000000453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]