SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000000459 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000000459
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000432
Further Details:      
 
Domain Number 2 Region: 242-370
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.83e-16
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000639
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000000459   Gene: ENSTBEG00000000531   Transcript: ENSTBET00000000528
Sequence length 445
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_112:36577:43653:1 gene:ENSTBEG00000000531 transcript:ENSTBET00000000528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGPVGGRPGGRGGPAVQQNIPSTLLQDHENQRLFEMLGRKCWTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSHLVYSTPTPFFHTFAGD
DCQAGLNFADEGEAQAFRALVQEKIQKRNQRQSGDRRQLPPPPAPANEXXXXXXPPLPPH
PSGDQGGPPTGPLSLGLVTVDIQNPDITSSRYRGLPAPVAGSADKKRSGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLLCFFSRXXXXXXXXXXXXXSLIYDFIEDQGGLE
AVRQEMRRQEPLPPPPPPSRAGNQPPRPPIVGGNKGRSGPLPPVPLGGAPPPPTPRGPPP
PGRGGPPPPPPPTTGRSGPPPPPPPVAGGPPLPPPPPPPPPPPSSMDGPVPPPPPPAPVT
GGGLAPGGGRGALLDQIRQGIQLNK
Download sequence
Identical sequences ENSTBEP00000000459 ENSTBEP00000000459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]