SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000000541 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000000541
Domain Number 1 Region: 37-132
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-26
Family SH2 domain 0.00000193
Further Details:      
 
Domain Number 2 Region: 150-197
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000000916
Family SOCS box-like 0.0000818
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000000541   Gene: ENSTBEG00000000636   Transcript: ENSTBET00000000623
Sequence length 198
Comment pep:novel scaffold:TREESHREW:scaffold_3736:3690:5913:1 gene:ENSTBEG00000000636 transcript:ENSTBET00000000623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRCLERSGNGSEGTQSQWGAEGSAEEPSPEAARLAKALRELSQTGWYWGGMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPPLQHLCRLTINKCTHTIWG
LPLPTRLKDYLEEYKFQV
Download sequence
Identical sequences ENSTBEP00000000541 ENSTBEP00000000541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]