SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000000655 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000000655
Domain Number 1 Region: 236-477
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 3.24e-56
Family Decarboxylase 0.000000433
Further Details:      
 
Domain Number 2 Region: 13-202
Classification Level Classification E-value
Superfamily PRTase-like 2.49e-40
Family Phosphoribosyltransferases (PRTases) 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000000655   Gene: ENSTBEG00000000762   Transcript: ENSTBET00000000753
Sequence length 479
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3612:864792:895279:1 gene:ENSTBEG00000000762 transcript:ENSTBET00000000753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGAALGPLVTGLYDVEAFKFGNFVLKSGLSSPVYIDLRGIVSRPRLLSQVADILFQT
AQEAGINFDSVCGVPYTALPLATVICSTNQIPMLIRRKEAKDYETKRMVEGAISGETCLV
IEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLE
ILEQQKKIDAEMVEKVKRFIQENVFVAANHNGSLPPVKKAPKELSFDAGAELPRIHPVAS
KLLRLMQKKETNLCLSADVSDARELLQLADALGPSICMLKTHVDILSDFTLDVMKELATL
AKRHEFLSFEDRKFADIGNTVRKQYEGGVFKIASWADLVNAHVVPGSGVVKGLQEVGLPL
NRGCLLIAEMSSAGSLATGSYTKAAVRMAEEHPEFVVGFISGSRVSMKPEFLHLTPGVQL
SAGGDSLGQQYSSPEEVVGKRGSDIIIVGRGILSAASRLEAAEMYRKAAWEAYLSRLGV
Download sequence
Identical sequences ENSTBEP00000000655 ENSTBEP00000000655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]