SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000000656 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000000656
Domain Number 1 Region: 62-360
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-40
Family FAD-linked reductases, N-terminal domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000000656   Gene: ENSTBEG00000000745   Transcript: ENSTBET00000000754
Sequence length 601
Comment pep:known_by_projection scaffold:TREESHREW:scaffold_123713:20031:32363:1 gene:ENSTBEG00000000745 transcript:ENSTBET00000000754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLSVKLLLALLLLVLSRVYRGLFAGSSTNPFKDVKRPPAPLVTDKEARKVLKQAFSASL
VPEKLDVVVIGSGIGGLAAAAILAKVGKRVLVLEQHTKWGCHTFQNVFDTGIHYIGRVNE
GSIGRLILDQITEGQLDWATLSSPFDIVVLEGPNGRKEFPMYSGKEAYIRGLKEKFPQEE
VVIDKYMKLVKEVASGATHAILLKYFPLLVAQLLNKCGLLTRFSPFLRASTQSLAEVLQQ
LGASPELQAVLSYIFPTYGVTPSHSTFSMHALLVNHYMKGAFYPRGGSSEIAFHTIPVIQ
RAGGAVLTRAAVQSVLLDSAGRACGVSVKKGQELVNIYCPIVISSAGLFNTYERLLPECA
RCLPGVKQQLGMVRPSSAMFSVFICLRGTKDDLGLPSTNYFVYYDTDVDKAMARYLSMPR
EKAAEHIPLVFVSSPSAKDPAWEDRFPGRSSLIALIPTAYEWFKEWQEEPQGKRGSDYEA
FKNSFVEAVVAEVKKLFPQLEGKVESVTGGTPLTNQFYLAAPQGACYGADHDLSRLHPLV
MASVRAQPIPNXXXXXQDVFTCGLMGALQGALLCSSAILERNLYLDLKNLGSRVRAQKKK
D
Download sequence
Identical sequences ENSTBEP00000000656 ENSTBEP00000000656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]