SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000000671 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000000671
Domain Number 1 Region: 108-276
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000146
Family FAD/NAD-linked reductases, N-terminal and central domains 0.017
Further Details:      
 
Domain Number 2 Region: 5-122
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000256
Family FAD/NAD-linked reductases, N-terminal and central domains 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000000671   Gene: ENSTBEG00000000781   Transcript: ENSTBET00000000769
Sequence length 322
Comment pep:novel scaffold:TREESHREW:scaffold_14753:41159:46186:-1 gene:ENSTBEG00000000781 transcript:ENSTBET00000000769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFLSTTGGVWVISRVFDSGYPWDMVFMTRIQNMFRNSLPTPLVSWFIARKMNSWFNHANY
GLVPEDRTQLREPVLNDELPGLIMTGKVLIRPSIKEVKENSVLFSSTPEEEPIDIIVFAT
GYTFVFPFLDESVVKVEDGQASLYKYIFPAHLQKPTLVVISLIKPLGSMIPTGETQARWA
VQVLKGVIKLPPPNVMIEEVNVRKKNKPSGFGLCYCRALQSDYITYIDELLTDINAKPNL
LSMLTDPRLALTVFFGLCTPYQFHLTGPGRWEGARNAILTQWDRTFKVTKTRIVQEPPPP
FESLLKLFSFLALLVAIFLVFL
Download sequence
Identical sequences ENSTBEP00000000671 ENSTBEP00000000671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]