SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000000964 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000000964
Domain Number 1 Region: 9-114
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 9.42e-21
Family AlaX-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000000964   Gene: ENSTBEG00000001124   Transcript: ENSTBET00000001118
Sequence length 277
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_5813:6181:11558:-1 gene:ENSTBEG00000001124 transcript:ENSTBET00000001118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELGRLRSVIELDSPSVTAEQVATIEQNVNEKIRDRLPVDVRELSLDDPEVEQVGRGLPDD
HAGPIRVITIKGVDSNMCCGTHVSNLSDLQVIKILGTEKGKKNKTNLVFLAGNRVLKWME
RSHGTEKALTALLKCGAEDHVEAVKLQNSALQNNLNLLRDLAVHTAHSLRNSSDWGGVVV
LHRKEGDSEFMNIIANEIGSEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVAEVLEG
KGAGKKGRFQGKATKMSRRTEVQALLQDYVSTQSAEE
Download sequence
Identical sequences ENSTBEP00000000964 ENSTBEP00000000964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]