SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000000996 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000000996
Domain Number 1 Region: 317-559
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.02e-59
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000174
Further Details:      
 
Domain Number 2 Region: 561-667
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.17e-28
Family Anticodon-binding domain of Class II aaRS 0.0011
Further Details:      
 
Domain Number 3 Region: 39-100
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000216
Family TGS domain 0.0052
Further Details:      
 
Domain Number 4 Region: 101-146
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 0.000000000075
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000000996   Gene: ENSTBEG00000001134   Transcript: ENSTBET00000001155
Sequence length 678
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5126:1633:58107:-1 gene:ENSTBEG00000001134 transcript:ENSTBET00000001155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKLQPNFIKERLKLFETLKEDRQLSRASYEAKEAVGHAITVRMADGKTVGGEAWKTTPYQ
VAAGVSQELAENTVVAKVNGELWDLDRPLEGDSSLELLTFDSEEAQAVYWHSSAHILGEA
MELYYGGHLCYGPPIENGFYYDMFIEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXYNKFKCRILNEKVNTPTTTVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXEEYHRRDFTEVLSPNMYNSRLWEASGHWQHYSENMFTFDVEKD
TFALKPMNCPGHCLMFAHRPRSWRELPLRFAFGVLHRNELSXXXXXXXXXXXXXXXXXXX
XXXXXXIEEEIKGCLQFLQSVYSTFGFSFQLNLSTRPEDFLGEVEVWNEAEKQLRNSLME
FGKPWQVNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPVRFNLTYVSKDGDDKKR
PVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMVIPVGPTCEEYALQVSNEFFEEG
FMADVDLDQSCTLNKKIRNAQLAQYNFILVVGEKEMINNAVNVRTRDNKIHGEISVTSAI
DKLKNLKRSRTLNAEEDF
Download sequence
Identical sequences ENSTBEP00000000996 ENSTBEP00000000996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]