SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000001064 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000001064
Domain Number 1 Region: 18-99
Classification Level Classification E-value
Superfamily Lysozyme-like 2.31e-33
Family C-type lysozyme 0.0000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000001064   Gene: ENSTBEG00000001243   Transcript: ENSTBET00000001233
Sequence length 99
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2074:51618:52630:1 gene:ENSTBEG00000001243 transcript:ENSTBET00000001233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALLVLGLLLSVTVQGKKYESCELARTMKKHGMHNFKGISLATWMCVAKWESGYNTKAI
NNNRKDQSTDYGIFQINSRYWCNDGKTPKAVNACRVSCN
Download sequence
Identical sequences ENSTBEP00000001064 ENSTBEP00000001064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]