SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000001393 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000001393
Domain Number 1 Region: 315-443
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 6.01e-31
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0000064
Further Details:      
 
Domain Number 2 Region: 2-59,180-240
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000793
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000001393   Gene: ENSTBEG00000001590   Transcript: ENSTBET00000001607
Sequence length 445
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5059:234:27104:-1 gene:ENSTBEG00000001590 transcript:ENSTBET00000001607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRWGLGGTCVNVGCIPKKLMHQAALLGGWIRDAHHYGWEVAQPVLHDWKKMAEAVQNHVK
SLNWGHRVQLQDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVALECAGFLTGIGLDTTVMMRSIPLRGFD
QQMSSLVTESMASHGTRFLRRCTPSRVRKLADGRLQVAWQDHATGKEDTGTFDTVLWAIX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGRSELSPTAIIAGRL
LAQRLFGQSTDLMDYDSVPTTVFTPLEYGCVGLSEEEAVARHGQEHVEVYHAYYKPLEFT
VAERDASQCYIKMVCLREPPQLVLGLHFLGPNAGEVTQGFAVGIKCGASYAQVMQTVGIH
PTCSEEVVKLRISKRSGLDPTVTGC
Download sequence
Identical sequences ENSTBEP00000001393 ENSTBEP00000001393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]