SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000001703 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000001703
Domain Number 1 Region: 16-192
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 6.28e-48
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.000000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000001703   Gene: ENSTBEG00000001976   Transcript: ENSTBET00000001962
Sequence length 204
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5571:23889:74518:1 gene:ENSTBEG00000001976 transcript:ENSTBET00000001962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSASCPAPALSTGKTFRVLVGVTGSVAALKLPLLVSRLLDIPGXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXMWKCRSDPVLHIDLRRWADLMLVAPLDANTLGKVASGICDNLL
TCIIRAWDCSKPLLFCPAMNTAMWEHPVTAQQVGLLKAFGYIEIPCVSKVLVCGDQGLGA
MAEVATIVDRVKEALSQRGALQQS
Download sequence
Identical sequences ENSTBEP00000001703 ENSTBEP00000001703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]