SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000001892 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000001892
Domain Number 1 Region: 92-150
Classification Level Classification E-value
Superfamily Leucine zipper domain 7.5e-21
Family Leucine zipper domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000001892   Gene: ENSTBEG00000002195   Transcript: ENSTBET00000002183
Sequence length 292
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5541:931328:938937:1 gene:ENSTBEG00000002195 transcript:ENSTBET00000002183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGH
LALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQA
ETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGS
AVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAIT
PGTSNLVFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSLNSPTLLAL
Download sequence
Identical sequences ENSTBEP00000001892 ENSTBEP00000001892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]