SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000002101 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000002101
Domain Number 1 Region: 230-351
Classification Level Classification E-value
Superfamily SH2 domain 1.28e-24
Family SH2 domain 0.00052
Further Details:      
 
Domain Number 2 Region: 355-394
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000667
Family SOCS box-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000002101   Gene: ENSTBEG00000002430   Transcript: ENSTBET00000002429
Sequence length 421
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4561:64483:122910:1 gene:ENSTBEG00000002430 transcript:ENSTBET00000002429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQPPVPELPPFPLQTVPPRLSRGQQQQHPPRPPPPGPLRPLAGPSRKGSFKIRLSRLFRT
KSCNGGSGGGDGTSKRPSGELAASAASLTDMGGSAGRELDAGXXXXXXXXXXXXXXXXXX
XXXXXETVSLVDVDISQRGLTSPHPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXAFPRIAPIRAAESLHSQPPQHLQCPLYRPDSSSFAASLRELEKCGW
YWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWC
HPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSSVKSLQH
LCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYYDPQEEVYLSLKEAQLISKQKQEVGPS
T
Download sequence
Identical sequences ENSTBEP00000002101 ENSTBEP00000002101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]