SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000002171 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000002171
Domain Number 1 Region: 320-681
Classification Level Classification E-value
Superfamily SIS domain 1.4e-80
Family double-SIS domain 0.00000496
Further Details:      
 
Domain Number 2 Region: 1-156
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 6e-37
Family Class II glutamine amidotransferases 0.0000895
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000002171   Gene: ENSTBEG00000002496   Transcript: ENSTBET00000002508
Sequence length 681
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2254:27506:47941:-1 gene:ENSTBEG00000002496 transcript:ENSTBET00000002508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFAYMNYRVPRTRREIFETLIKGLQRLEYRGYDSAGVAIDGHSQEVKGRQIRLVKKQGKV
TALDEELHKQDNMDLKVEFETHFGLAHTRWATHGVPNAVNSHPQRSDKGNEFVVIHNGII
TNYKDLKKFLESKGYEFESETDTEAIAKLIKYVFDHREAEDGTFSMLAERVIQQLXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNIENAKNACKSRVKRLD
STTCLHAEGDKAVEFFFASDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXNFSAFMQKEIFEQPESVFNTMRGRVDFETNTVLLGGLKDHL
KEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFI
SQSGETADTLLALRYCKDRGALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKAYTS
QFVSLVLFGLMMSEDRVSLQTRRQEIIRGLKELPELIKEVLSLDTKIHGLALELYTQRSL
LVMGRGYHYATCLEGALKIKEITYMHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXGRPIILCSKDDTESSKLAYRAIELPRTVDCLQGVLSVVPLQLLSFHL
AVLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences ENSTBEP00000002171 ENSTBEP00000002171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]