SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000002385 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000002385
Domain Number 1 Region: 144-320
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 7.33e-54
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000764
Further Details:      
 
Domain Number 2 Region: 321-472
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.78e-53
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000118
Further Details:      
 
Domain Number 3 Region: 82-142
Classification Level Classification E-value
Superfamily TGS-like 0.0000000000000183
Family TGS domain 0.0055
Further Details:      
 
Domain Number 4 Region: 614-708
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.0000015
Family Anticodon-binding domain of Class II aaRS 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000002385   Gene: ENSTBEG00000002740   Transcript: ENSTBET00000002754
Sequence length 722
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1460:54634:77871:1 gene:ENSTBEG00000002740 transcript:ENSTBET00000002754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVENNSGGLGSMGGEEKPVDTSQEKQKEGKKKNKEGSGDGGRAELNPWPEYINTRLEMY
NKLKAEHDSILAEKAEKDSKPIKVTLPDGKQVHAESWKTTPYQIACGISQGLADNTVIAK
VNKVVWDLDRPLEEDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIEN
GFYYDMFLEEGGVSSNDFSSLEALCKKIIKEKQAFERLEVKKETLLEMFKYNKFKCRILN
EKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKTLKIHKNSSTYWEGKADMETLQRIYGIS
FPDPKMLKEWEQFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNTLIEFIR
SEYRKRGFQEVVTPNIYNSRLWMTSGHWQHYSENMFSFEVEKELFALKPMNCPGHCLMFD
HRPRSWRELPLRVADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXPFWLSPRQVMVIPVGPTCDEYAQKXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXVGEKEKTSGTVNIRTRDNKVHGERTISETIERLQQLKRSRNKQAEE
EF
Download sequence
Identical sequences ENSTBEP00000002385 ENSTBEP00000002385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]