SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000002419 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000002419
Domain Number 1 Region: 3-231
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000129
Family FAD-linked reductases, N-terminal domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000002419   Gene: ENSTBEG00000002775   Transcript: ENSTBET00000002791
Sequence length 299
Comment pep:known_by_projection scaffold:TREESHREW:scaffold_144436:19065:30971:-1 gene:ENSTBEG00000002775 transcript:ENSTBET00000002791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRVAVIGAGVSGLSSIKCCLVEGLERSDNIVGLMFAESPKDGMTRVYRSLVTNVCKEM
SCYTDCPFQEPFFLRIHKFKGQILHSQKYKIDGFQKLVIGLRNTGGDIAVELSTAAQRKM
KFVVNDELPTCILCGTVTLKTGLCEIPPSQKLMAEAITKERLIRRVVIKDTSEDNLDYIP
YIDLTACIGTKPSIPFLFLTDPRLAWEVFFGPCTSYLYCLVGPGKWEGARNAILTQDRTL
KPLKTRLLPEPPKPAPTLHSLKAWGTLVLFASLLLIYKSSLCLKLVPGKLDRIFSLEWG
Download sequence
Identical sequences ENSTBEP00000002419 ENSTBEP00000002419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]