SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000002460 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000002460
Domain Number 1 Region: 22-148
Classification Level Classification E-value
Superfamily Lysozyme-like 1.96e-48
Family C-type lysozyme 0.0000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000002460   Gene: ENSTBEG00000002857   Transcript: ENSTBET00000002840
Sequence length 160
Comment pep:novel scaffold:TREESHREW:scaffold_148165:4024:7332:1 gene:ENSTBEG00000002857 transcript:ENSTBET00000002840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSWGTVVVTLAIVMVATVDAKIYERCELARKLEKAGLNGYRGYTIGDWLCMAHYESGFD
TSFVNHNPDGSSEYGIFQLNSAWWCDNGVTPSQNLCHMDCRDLLNRHILDDILCAKRIVS
SHNSMTAWNSWTKHCSGHDLSGWIKGCDMNVKTDPKKINS
Download sequence
Identical sequences L8YDA3
XP_006165040.1.99106 ENSTBEP00000002460 ENSTBEP00000002460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]