SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000002485 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000002485
Domain Number 1 Region: 250-292
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000589
Family SOCS box-like 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000002485
Domain Number - Region: 81-178
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000124
Family Ankyrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000002485   Gene: ENSTBEG00000002889   Transcript: ENSTBET00000002871
Sequence length 295
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3385:3949:23708:-1 gene:ENSTBEG00000002889 transcript:ENSTBET00000002871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKSSKLCRKTACPRSNIFCNLIDKIVKRPSLQFLGQWGYHCYEPRIYRTLAKILTYVDL
DGFDRLLTDYIAFVEKSGYRFELNFNLEFTEICVNTILYWVFARKGNPDFVELLLKKTKD
YVQDRSCNLALIWRTFTPVYCPSPLRGITPLLYVAQTRQSNILKILLQYGILEREKNPVN
IVLTILLYPSRVRIMIDHELVDMQEDAKTCLVLCSRVLSVISMREIETQLSLGRHPIISD
WLDYIPSTRYKDPCELLHLCRITIRTQLLANNMLPNGIFSLLIPVRLQNYLNLES
Download sequence
Identical sequences ENSTBEP00000002485 XP_006146120.1.99106 ENSTBEP00000002485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]