SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000002719 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000002719
Domain Number 1 Region: 13-190
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 7.97e-24
Family Protein-L-isoaspartyl O-methyltransferase 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000002719
Domain Number - Region: 338-356
Classification Level Classification E-value
Superfamily SOCS box-like 0.0863
Family SOCS box-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000002719   Gene: ENSTBEG00000003150   Transcript: ENSTBET00000003142
Sequence length 358
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5372:138237:172034:1 gene:ENSTBEG00000003150 transcript:ENSTBET00000003142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGAVSAGEDNDELIDNLKEAQYIRTELVEQAFRAIDRADYYLEEFKENAYKDLAWKHGN
IHLSAPCIYSEVMEALDLQPGLSFLNLGSGTGYLSSMVGLILGPFGVNHGVELHSDVIEY
AKQKLDFFIRTSDSFDKFDFCEPSFVTGNCLELSPECSQYDRVYCGAGVQKEHEEYMKNL
LKVGGILVMPLEEKLTITRTGPSAWEKKILAVSFAPLIQPCRSEAGKPRLVQLPPLAVRS
LQDLARIAIRGTIKKLIHQEAVSKTGNGLKNTPRFKRRRVRRRRMETIVFLDKEVFASRI
SNPSDDNSCEDLEEEHREEEKTLPETKPDPPVNFLRQKVLSLPLPDPLKYYLLYYREK
Download sequence
Identical sequences ENSTBEP00000002719 ENSTBEP00000002719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]