SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000002760 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000002760
Domain Number 1 Region: 3-113
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.83e-29
Family Chaperone J-domain 0.0000798
Further Details:      
 
Domain Number 2 Region: 241-328
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 3.53e-23
Family HSP40/DnaJ peptide-binding domain 0.00022
Further Details:      
 
Domain Number 3 Region: 158-239
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.00000000000017
Family HSP40/DnaJ peptide-binding domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000002760   Gene: ENSTBEG00000003204   Transcript: ENSTBET00000003188
Sequence length 335
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_3707:6556:19230:1 gene:ENSTBEG00000003204 transcript:ENSTBET00000003188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKDYYGILGIEKGASEEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKK
REIFLPSPHARLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPLEIFFGRRMAGGR
SEEMEIDGRSFSAFGFSMNGYPRDRNSVGPSRLKQDPPVIHELRVSLEEIYSGTKRMKIS
RKRLNPDGRSYRSEDKILTIEIKKGWKEGTKITFPREGDETPNSIPADIVFIIKDKDHPK
FKRDGSNIIYTAKISLREALCGCSINVPTMDGRNIPMSINDIVKPGMRRRIIGYGLPFPK
NPDQRGDLLIEFEVSFPDTISSSSKEVLRKHLPAS
Download sequence
Identical sequences ENSTBEP00000002760 ENSTBEP00000002760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]