SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003018 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003018
Domain Number 1 Region: 12-111,264-395
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.27e-29
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000003018
Domain Number - Region: 138-184,239-268,306-345
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000168
Family FAD/NAD-linked reductases, N-terminal and central domains 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003018   Gene: ENSTBEG00000003481   Transcript: ENSTBET00000003481
Sequence length 502
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1823:127279:147256:1 gene:ENSTBEG00000003481 transcript:ENSTBET00000003481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAARPPPTEGKFVVVGGGIAGVTCAEQLALHFPSEDILLITASPVIKAITNFKQVSKVL
EEFDVEEQPGTMLENRFPNIKVIESGVKELKSEEHYILTEDGSKLEYKKLCLCAGARPKL
ICEGNPYVLGIRDTDSAQEFQKQLTQAKRIMIIGNGGIALELVYEIEGCEIIWAIKDKAI
GNTFFDAGAAEFLTSKLIAEKSDAKIAHKRTRYTTEXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXFSHKIHIETTCEVKKIYLQEEFILSKKKSLTFPRHHHKSVTTDKGNLWPV
YVELTNEKIYGCDFIVSATGVIPNTDPFLHGNNFDLGEDGGLKVDDHMQTSLPDVYAAGD
ICTASWQPSPFWQQMRLWTQARQMGWYAAKCMAAASSGDTIDMDFSFELFAHVTKFFNYK
VVLLGKYNAQGLGSDHELMLRFTKGREYIKVVMLNGRMMGAVLIGDTDLEETFENLILNQ
MNLSSYGEDLLDPNIDIEDYFD
Download sequence
Identical sequences ENSTBEP00000003018 ENSTBEP00000003018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]