SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003139 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003139
Domain Number 1 Region: 25-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000196
Family LDL receptor-like module 0.00016
Further Details:      
 
Domain Number 2 Region: 142-182
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000055
Family LDL receptor-like module 0.00023
Further Details:      
 
Domain Number 3 Region: 103-143
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000011
Family LDL receptor-like module 0.00015
Further Details:      
 
Domain Number 4 Region: 197-233
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.00027
Further Details:      
 
Domain Number 5 Region: 66-104
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000746
Family LDL receptor-like module 0.00014
Further Details:      
 
Domain Number 6 Region: 666-714
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000614
Family EGF-type module 0.00025
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000003139
Domain Number - Region: 532-570
Classification Level Classification E-value
Superfamily YWTD domain 0.0222
Family YWTD domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003139   Gene: ENSTBEG00000003617   Transcript: ENSTBET00000003617
Sequence length 715
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2159:7839:36305:1 gene:ENSTBEG00000003617 transcript:ENSTBET00000003617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRANWGLCWAIALLLAAAGAAAEYKCERNEFQCRDGKCISYKWVCDGLPECQDGSDESQ
ETCRSVTCKAGDFSCGGRVNRCIPQSWRCDSQVDCENGSDEQGCAPRTCSQDEFRCHDGN
CISRQFVCDSDRDCLDGSDEAACQTPTCGPSDFRCNSSTCIPALWACDGEPECEDGSDEW
PQNCQGRNTSSPRADLSPCSALEFHCGSGECIHSSWRCDNDPDCKDKSDEDGCXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFMYWTDWGT
PAKIEKGGLNGVDVYSLVTEDIQWPNGITLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXDKVFWTDILNEAIFSANRLTGSDVHLLVENLHSPEDLVLFHNL
TQPRGVNWCERTTLRNGGCQYLCLPAPQINPHSPKFTCACPDGSSLAKDMRSCRT
Download sequence
Identical sequences ENSTBEP00000003139 ENSTBEP00000003139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]