SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003250 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003250
Domain Number 1 Region: 36-131
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-24
Family SH2 domain 0.00000318
Further Details:      
 
Domain Number 2 Region: 150-195
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000000575
Family SOCS box-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003250   Gene: ENSTBEG00000003767   Transcript: ENSTBET00000003746
Sequence length 196
Comment pep:novel scaffold:TREESHREW:scaffold_97658:12217:12806:1 gene:ENSTBEG00000003767 transcript:ENSTBET00000003746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRCLRSRNGAEGTQSQWGAAGSAEELFPQAAQLAKALWELSQTGWYWGGMTVNEAKEK
LKEAPEGTFLIRDSSHSDYLLMVSVKTSAGPTNLRIKYRDGKFRLDSIICIKSKLKQFDS
VVRLMDYYVQMCKDKRTGPEAPGNGTVHRYLTKPLYTSAPPLQHLCRLTINKCTHTIWGL
RLPTRLKDYLEEHKFQ
Download sequence
Identical sequences ENSTBEP00000003250 ENSTBEP00000003250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]