SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003439 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003439
Domain Number 1 Region: 116-210
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1.03e-21
Family Transforming growth factor (TGF)-beta 0.00000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003439   Gene: ENSTBEG00000003986   Transcript: ENSTBET00000003965
Sequence length 211
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_583:333602:359880:-1 gene:ENSTBEG00000003986 transcript:ENSTBET00000003965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQ
FDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQTAAANPENSRGKGRRGQRGKNRGCVL
TAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSKNRRLVSDKVGQACCR
PLAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Download sequence
Identical sequences ENSTBEP00000003439 XP_006156374.1.99106 ENSTBEP00000003439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]