SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003453 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003453
Domain Number 1 Region: 198-432
Classification Level Classification E-value
Superfamily SIS domain 5.72e-19
Family mono-SIS domain 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000003453
Domain Number - Region: 6-84
Classification Level Classification E-value
Superfamily SIS domain 0.0572
Family mono-SIS domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003453   Gene: ENSTBEG00000003971   Transcript: ENSTBET00000003981
Sequence length 529
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1539:218507:244816:1 gene:ENSTBEG00000003971 transcript:ENSTBET00000003981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPDGGLVVLSGGGSGRMAFLMSVSFNQLMKGLGQKPLYTYLIAGGDRSVVASRERTEDSA
LHGIEELKKVAAGKKRVIVIGISVGLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXCLLEILRTFERAHQVTYSQSPKIATLMKQVSTSLEKKGRVHLVGWQ
TLGIIAIMDGVECIHTFGADFRDVRGFLIGDHSDMFNQKAELTNQGPQFSFSQEDFLTSI
LPSLTEIDTVVFIFTLDDNLKEVQTLAEQVREKTSNIQALAHSIVGQSLPTPLKKLFPSI
ISITWPLLFFEYEGNFVQKFQRELSTKWVLNTVSTGAHVLLGKILQNHMLDLRISNSKLF
WRALAMLQRFSGQSKAQCIESLLQVIHFPQPLSDDIRAAPISCHIQIAHEKEQVIPIALL
SLLFRCSIPEAQAYLAAAPSVCEAVRNALTGPGRKRNADPLETLEPAVQ
Download sequence
Identical sequences ENSTBEP00000003453 ENSTBEP00000003453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]