SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003616 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003616
Domain Number 1 Region: 63-189
Classification Level Classification E-value
Superfamily Lysozyme-like 2.47e-46
Family C-type lysozyme 0.0000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003616   Gene: ENSTBEG00000004175   Transcript: ENSTBET00000004173
Sequence length 191
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_1790:275843:322708:1 gene:ENSTBEG00000004175 transcript:ENSTBET00000004173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPKTHVSCPSVTESSISSTESPASVSGAGTRYLHFQFHLAASGMKVAAVLTLLGFLVTAT
ESKVYTRCKLAKIFSRAGLDNYGGFSLGNWICMAYYESHYNTTAQTILEDGSVDYGIFQI
NSFTWCRHAKLQEKNHCHVACSALVTDDLTDAIICAKKIVKETEGMNYWQGWKKNCEGKD
VSEWKKGCEVS
Download sequence
Identical sequences ENSTBEP00000003616 ENSTBEP00000003616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]