SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003676 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003676
Domain Number 1 Region: 9-219,325-382
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.68e-49
Family FAD-linked reductases, N-terminal domain 0.000048
Further Details:      
 
Domain Number 2 Region: 223-325
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.79e-23
Family D-aminoacid oxidase-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003676   Gene: ENSTBEG00000004253   Transcript: ENSTBET00000004249
Sequence length 390
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_309:178987:194100:1 gene:ENSTBEG00000004253 transcript:ENSTBET00000004249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQNGLWDTIVIGAGIQGCFTAYHLASHGKTVLLLEQFFLPHSRGSSHGQSRIIRKAYA
EDFYAHMMDECYRIWAQLEHEAGTQLYRQTGLLLLGMKENPELKTIQATLSRQRVEHQCL
SSEELKQRFPNIRMSRGEVGLLETCGGVLYADKALRALQGVVRQRGGTVRDGEKVIEIKP
GLPVLVKTTSGSYRAKSLVITAGPWTNRLLRPLGLELPLQTLRVNVYYWQEKVAGSYGAS
QAFPCFLGLDLAPQHIYGLPAGEYPGLMKVCYHHGNSADPEERDGPTACSDSQDIRILRG
FVRDHLPDLKPEPSVMECCMYTNTPDRHFVLDRHPMYDNIVIGAGFSGHGFKLSPVVGKI
LCELSMKVTPSYDLTPFRISRFSGLGKAHL
Download sequence
Identical sequences ENSTBEP00000003676 ENSTBEP00000003676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]