SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003872 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003872
Domain Number 1 Region: 6-47
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 7.06e-16
Family Skp1 dimerisation domain-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003872   Gene: ENSTBEG00000004506   Transcript: ENSTBET00000004486
Sequence length 47
Comment pep:novel scaffold:TREESHREW:scaffold_44811:535:675:1 gene:ENSTBEG00000004506 transcript:ENSTBET00000004486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTV
Download sequence
Identical sequences ENSTBEP00000003872 ENSMMUP00000041158 9544.ENSMMUP00000041158 ENSETEP00000002125 ENSETEP00000002125 ENSMMUP00000041158 ENSTBEP00000003872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]