SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000004012 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000004012
Domain Number 1 Region: 626-816
Classification Level Classification E-value
Superfamily Macro domain-like 1.85e-53
Family Macro domain 0.0000666
Further Details:      
 
Domain Number 2 Region: 1043-1231
Classification Level Classification E-value
Superfamily Macro domain-like 6.06e-41
Family Macro domain 0.00074
Further Details:      
 
Domain Number 3 Region: 861-1013
Classification Level Classification E-value
Superfamily Macro domain-like 7.91e-36
Family Macro domain 0.0003
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000004012
Domain Number - Region: 1395-1434
Classification Level Classification E-value
Superfamily WWE domain 0.00381
Family WWE domain 0.021
Further Details:      
 
Domain Number - Region: 18-91
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00429
Family Canonical RBD 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000004012   Gene: ENSTBEG00000004639   Transcript: ENSTBET00000004654
Sequence length 1436
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_5864:575280:635233:1 gene:ENSTBEG00000004639 transcript:ENSTBET00000004654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIMLVENLSGLSSDDFRIEIIRDCDVAVVTFTKHIDAMKFVEDCVKHRRVQQLQLSPRL
LEVTKTIRVENLPPGVDDYNLKLFFENPYHGGGRVAHVECFPEESSALIEFADSKXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEYNSSSDTVVISEFTSATAA
EVIIAGLLKEVDETYTSVFDFMEKHMKIERLVEVKPSLVIDYLKSEKKFWAKGKNTNVQV
IFNTENKPKGILLVGPKIEVLKGVDIVKQAWESVYVKSIHVDKPGAREFFQDKARYYKGE
VRRMFGCFIELQESEDKEGGSSGQRCLSRADLAPGVTLLVQQGDLTHFPVEVVVNTANED
LKHSGGLAAALSKAAGPELQAHCDQIVKKKGKVFPGSATISKAGKLPYLHVIHAVGPQWK
AGEAEGCAFLLRKAVEQILQLAKEHKVRSIAIPAISSGVFGFPLQECAKTIVLTIKENFQ
YSQDGCTLKEIYLVDASEKSAEAFAEAVKALFKTSLPKPAFLSSLPAAAAXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXADVVVNSNPSDLVLNNGPLSRAILEKAGPKLQEELNTVG
QGVAASVGTILQTSGCNLACQRVLHVVAPEWKNGSTSSQKVMEDIISQCLEITESLSFKS
IAFPAIGTGNLRFPKTVFAELIISEVFKFSSKNQLTALQEVFFMLHPSDYENIQXXXXXX
XXXXXXXXXXXXXXXXXXXXXFYGAVSSPNLGVHEMKIGPITFQVASGDITKEAADVIVN
STSKSFTLKAGVSKAILENAGQNVEAECSRLAQQGKHDYIITEGGLLRCKKIIHVVGGND
VKLSVSCVLRECEKQNYSSVCFPAIGTGSAQKDSDKVAEDMIDAIEDFIQKGQVQSVKKV
KVVIFQPQILDVFYANMKKREGTQVSPQPSMMSKVASFFGFQKQPPQKKNPLVLEKKTER
AIFQVCGENVKSVENTISWIQELIEKEQFLYTSDDECIKYFDEKGNQELNDLLKKLKITI
SLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXAKRTKKETVGVKINNRSYTVDLKTHTATDTRGDSLPLQRLTKLE
Download sequence
Identical sequences ENSTBEP00000004012 ENSTBEP00000004012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]