SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000004194 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTBEP00000004194
Domain Number - Region: 339-375
Classification Level Classification E-value
Superfamily WWE domain 0.0157
Family WWE domain 0.0085
Further Details:      
 
Domain Number - Region: 545-595
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0161
Family SAM (sterile alpha motif) domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000004194   Gene: ENSTBEG00000004865   Transcript: ENSTBET00000004870
Sequence length 812
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1190:19034:59258:1 gene:ENSTBEG00000004865 transcript:ENSTBET00000004870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERKPNGGSGGASASSSGTNLLFSSSATEFSFNVPFIPVTQAAAAPASLLLPGEDSTDV
GEEDSFLGQTSIHTSTPQTFSYFSQVSSSSDPFGNIGQSPLTTAATPVGQSAFSKPPTAL
PYTAGSQEVVNAFSPSVSKAQYGAPPSSQMGLNSYLPSQPSSSLPPSNFGSPPQGTPQQG
YNPYRHNPVSSRANPYIAPPQLQQCQTPSLPTHLPPSGPSGPPVQMYQMPPGSLPPXXXX
XXXXXQQQVLARSAGPSMQVPPPFLLQNQYEPVQPHWFYCKEVEYKQLWMPFSVFDSLNL
EEIYNSVQPDPESVVLATDGGRYDVYLYDRMRKAVYWEEEPAEVRRCTWFYKGDTDSRFI
PYTEEFSEKLEDDFRVVSLKLLQTHFKTSLDDRKISRVEFLPVHWHSSLGGDATGVDXXX
XXXXXXXXXXXXXXXXXXXXXXLFYNSPTYCQSEEKVGMEITRLHALFMSRNPDFKGGVS
VAGHSLGSLILFDILSNQKDLKLSKTPGPLAVANGVMKQPHFQEKQVPEEPKPPLDESCD
LDVENEEVLTLQETLEAFSLSEYVSTFEKEKIDMESLKVRIPLGPRKKIANFVKHKAAKL
KKIASEKKAAMATSTKGQEESAQKTKEVASLPSDANESKRKLPVGAYVSSVRVDYESFEV
GTGQVSVVYNSLDFEPEIFFALGSPIGMFLTIRGVDRIDENYKLPTCKGFFNIYHPLDPV
AYRLEPMIVPDLDLKAVLIPHHKGRKRLHLELKESLSRMGSDLKQGFISSLKSAWQTLNE
FARAHTSSTQLQEELEKVANQIKEEEEKQVVE
Download sequence
Identical sequences ENSTBEP00000004194 ENSTBEP00000004194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]