SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000004211 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000004211
Domain Number 1 Region: 86-408
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.83e-102
Family Phosphofructokinase 0.00000035
Further Details:      
 
Domain Number 2 Region: 410-627
Classification Level Classification E-value
Superfamily Phosphofructokinase 7.32e-59
Family Phosphofructokinase 0.0001
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000004211
Domain Number - Region: 679-734
Classification Level Classification E-value
Superfamily Phosphofructokinase 0.00068
Family Phosphofructokinase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000004211   Gene: ENSTBEG00000004870   Transcript: ENSTBET00000004891
Sequence length 734
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_6135:212972:253394:1 gene:ENSTBEG00000004870 transcript:ENSTBET00000004891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGKEFHLKFFMCMVQSRQLVRIPQRTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXIPIFKTEWIMTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVF
FVHEGYQGLVDGVDNIREATQSVSMMLQLGGTVIGSARCKDFRDREGRLRAAHNLVKRGI
TNLCVIGGDGSLTGADTFRSEWSDLLSDLQKAGKITAEEATKSSYLNIVGLVGSIDNDFC
GTDMTIGTDSALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFI
PECPPDDDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYD
TRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLME
CVQVTKDVTKAMDEKKFDEAMKLRGRSFMNNWEVYKLLAHVRPPVSKSGAHTIAVMNVGA
PAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTK
RTLPKKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQYDELCIPFVVIPATVS
NNVPGSDFSIGADTALNTICTTCNLIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKG
IFDSRKNVLGHMQQ
Download sequence
Identical sequences ENSTBEP00000004211 ENSTBEP00000004211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]