SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000004384 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000004384
Domain Number 1 Region: 240-281
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000209
Family SOCS box-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000004384   Gene: ENSTBEG00000005101   Transcript: ENSTBET00000005089
Sequence length 282
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_888:83875:85794:-1 gene:ENSTBEG00000005101 transcript:ENSTBET00000005089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAASEPVPSGAPWAPARPEPPPTRFHRVHGANIRVDPSGTRATRVESFAHGVCFSREPL
APGQVFLVEIEEKELGWCGHLRLGLTALDPASLAAVPEFSLPDLVSLGHTWVFAITRHHN
RVPREGRPESEAVAPSRPPALLMEPYLCIEQFRIPRDRLVGRSRPGLYSHLDQLYELNVL
PPTARRSRLGVLFCPRPDGTADMHIVIGEDMGSARGLPAAQPLYAVVDVFASTKSVRLVQ
LEYGLPSLQTLCRLVIQRSVVHRLAIDGLHLPKGLKDFCKYE
Download sequence
Identical sequences ENSTBEP00000004384 ENSTBEP00000004384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]