SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000004414 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000004414
Domain Number 1 Region: 6-47
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.0000000000196
Family Skp1 dimerisation domain-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000004414   Gene: ENSTBEG00000005149   Transcript: ENSTBET00000005124
Sequence length 47
Comment pep:novel scaffold:TREESHREW:scaffold_138068:37743:37883:1 gene:ENSTBEG00000005149 transcript:ENSTBET00000005124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NKLKRTDDIPVPDQGFLKVDQGTLFALLLAANYLGIKDLLDVTCNTV
Download sequence
Identical sequences ENSTBEP00000000095 ENSTBEP00000004414 ENSTBEP00000000095 ENSTBEP00000004414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]