SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000004828 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000004828
Domain Number 1 Region: 38-323,508-571
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.01e-72
Family FAD-linked reductases, N-terminal domain 0.0025
Further Details:      
 
Domain Number 2 Region: 330-512
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.57e-56
Family GMC oxidoreductases 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000004828   Gene: ENSTBEG00000005590   Transcript: ENSTBET00000005608
Sequence length 591
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3519:521346:526895:-1 gene:ENSTBEG00000005590 transcript:ENSTBET00000005608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWCVLRGWRQGHLGWPGALGPWCPLGVRALASAGPRGEDEYSYVVVGAGSAGCVLASRLT
EDPDERVLLLEAGPKDMSAGSKRLSWKIHMPAALVANLCNDRYNWCYHTEPQQGLDGRVL
YWPRGRVWGGSSSLNAMVYIRGHAEDYNRWHRQGAEGWDYEHCLPYFRKAQGHELGASRY
RGGDGPLRVTRGKTNHPLHASAAQQCYLTDHVGFIQEGFGWMDMTVHQGKRWSAACAYLH
PALSRPNLRAEVRALAHRVLFEGTRAVGVEYVQNGQSHRXXXXXXXXXXXXXXEGPSNSP
QLLMLSGVGNAEDLRLGIPVVCHLPGVGQNLQDHLEIYIQQACTHPITLHSAQKPLRKVC
IGLEWLWKFTGYGATAHLETGGFIRSQPGVPHPDIQFHFLPSQVIDHGRVPTQQEAYQVH
VGTMRGTSVGWLKLRSANPRDHPVIQPNYLSTEADIKDFRLCVKLTREIFAQAALAPFRG
KELQPGSHVQSDQEIDAFVRAKADSAYHPSCTCRMGQPSDPAAVVDPQARVLGVENLRVV
DASIMPSVVSGNLNAPTIMIAEKAADMIKARPALRDKDVPVYKPRTLATQR
Download sequence
Identical sequences ENSTBEP00000004828 ENSTBEP00000004828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]