SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000004919 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000004919
Domain Number 1 Region: 399-474
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000726
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000004919   Gene: ENSTBEG00000005709   Transcript: ENSTBET00000005713
Sequence length 474
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4887:11:53385:1 gene:ENSTBEG00000005709 transcript:ENSTBET00000005713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YGLYSAFMGCFVYFFLGTSRDVTLGPTAIMSLLVSFYTFREPAYAVLLAFLSGCIQLAMG
LLRLGFLLDFISCPVIKGFTSAAAVIIGFGQVKXXXXXXXXXXXXXXXXXXXXXXXXXXX
VGDAALGLVCMVLLLVLKLMRDHVPPVHPEMPPGVRLSHGLVWTATTXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDIGAGLAVVPLMGL
LESIAIAKAFXXXXXXXXXXXXXXXXXXLTNVLGSLVSSYPVTGSFGRXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDLAPL
CVTFLLCFWEVQYGILAGVLTSVLILLHAVARPQTQVSEGPVLVLQPASGLHFPAVEALR
EAVLSRALQGSPPRSAVLECTHVCSVDYTVVRGLGELLEDFSRQGVTLAFAGLQ
Download sequence
Identical sequences ENSTBEP00000004919 ENSTBEP00000004919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]