SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000004971 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000004971
Domain Number 1 Region: 9-247
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.15e-40
Family WD40-repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000004971   Gene: ENSTBEG00000005770   Transcript: ENSTBET00000005770
Sequence length 287
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1373:146552:154335:1 gene:ENSTBEG00000005770 transcript:ENSTBET00000005770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KWTPVADFTHHAHTASLSAVAVNSRFLVTGSKDETIHIYDMKKKTDHGALVHHNGTITCL
KFYGNRHLISGAEDGLICVWDAKKWECLKSIRAHKGHVTFLSIHPSGKLALSVGTDKTLR
TWNLVEGRSAFIKNIKQNAHIVEWSPKGEKYVVVILNKIDIYHLDTASISTITNEKRVSS
VTFLSRSVLVDEEVVFDCDSQLCLCEFKAHENRVKDMCSFEIPEYHIMVTASNDGFIKMW
KLQQDQKVPPSLLCEVNTHARLTCLGVWLDTVTDTKESLPPAAEPSS
Download sequence
Identical sequences ENSTBEP00000004971 ENSTBEP00000004971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]