SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005084 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005084
Domain Number 1 Region: 235-279,306-452
Classification Level Classification E-value
Superfamily GAF domain-like 2.63e-29
Family GAF domain 0.0011
Further Details:      
 
Domain Number 2 Region: 483-576
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.06e-26
Family PDEase 0.00043
Further Details:      
 
Domain Number 3 Region: 730-827
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.33e-24
Family PDEase 0.0003
Further Details:      
 
Domain Number 4 Region: 52-157
Classification Level Classification E-value
Superfamily GAF domain-like 1.22e-17
Family GAF domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005084   Gene: ENSTBEG00000005887   Transcript: ENSTBET00000005908
Sequence length 834
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2344:288:217582:1 gene:ENSTBEG00000005887 transcript:ENSTBET00000005908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSEEQVRQFLDENPSFTHWYFGKRLSPENVLSACEEGLPADCGSLRELCQVEESAALF
ELVQDMQESVNMEQVLFKTLRRLCAILQADRCSLFLYRQRNGVAELATRLFSVQPDSVLE
DCLVAPDSEIVFPLDIGVVGHVAQTKKMVNVRDVTEXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXVFSKYLNFATLNLKIYHLSYLHNCETRRGQVLL
WSANKVFEELTDIERQFHKAFYTVRAYLNCERYSVGLLDMTKEKEFFDVWPVLMGEAQPY
SGPRTPDGREIIFYKVIDYILHGKEDIKVVPTPPADHWALVSGLPTYVAESGFICNIMNV
SADETFKFQDGPLDDSGWVIKNVLSMPIVNKKEEIVAVATFYNRKDGKPFDEQDEVLMES
LTQFLGWSVLNTDTYDKMNKLENRKDIAQDMVLHVRCDKDEIQSVLPTRERLGKEPAECE
EEELAEILKEELPGPTKFDIYEFHFSDLECTELDLVKCGIQMYFELGVVRKFQIPQEVLV
RFLFSVSKGYRRVTYHNWRHGFNVAQTMFTLLMXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXVALLVAAEFWEQGDLERTVLNQQPIPMMDRNKAAELPKLQVGFIDFVCTF
VYKVFSRFHEEILPMFDRLQNNRKEWKALADKYEAKVRALEEEKKEEEEVAAKK
Download sequence
Identical sequences ENSTBEP00000005084 ENSTBEP00000005084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]