SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005136 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005136
Domain Number 1 Region: 126-254
Classification Level Classification E-value
Superfamily DNA clamp 2.01e-47
Family DNA polymerase processivity factor 0.000000375
Further Details:      
 
Domain Number 2 Region: 1-125
Classification Level Classification E-value
Superfamily DNA clamp 1.22e-38
Family DNA polymerase processivity factor 0.000000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005136   Gene: ENSTBEG00000005968   Transcript: ENSTBET00000005967
Sequence length 260
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_676:99202:105747:-1 gene:ENSTBEG00000005968 transcript:ENSTBET00000005967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDL
DVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIK
LSQTSNVDKEEEAVSIEMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYKI
ADMGHLKYYLAPKIEDEEGS
Download sequence
Identical sequences ENSTBEP00000005136 ENSTBEP00000005136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]