SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005210 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005210
Domain Number 1 Region: 86-130
Classification Level Classification E-value
Superfamily TGS-like 0.0000425
Family TGS domain 0.029
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000005210
Domain Number - Region: 136-190
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 0.0011
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005210   Gene: ENSTBEG00000006067   Transcript: ENSTBET00000006053
Sequence length 196
Comment pep:known_by_projection scaffold:TREESHREW:scaffold_150603:103937:112037:-1 gene:ENSTBEG00000006067 transcript:ENSTBET00000006053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAMARGVRCLRLLQVVPGDGAGWRFIATSAATQLSPSKLTEMRNDLFNKEKSRQLSLTP
RTEKIEVKHVGKTDPGTVFVMNKNISTPYSCAMHLNEWYCRKSILALVDGQPWDMYKPLT
KSCEIKFLTFKDPDPGEVNKAYWRSCAMMMGCVIERAFKDEYMVSLARAPEIPVIAGAFC
YDVVLDKRLDEWMPTK
Download sequence
Identical sequences ENSTBEP00000005210 ENSTBEP00000005210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]