SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005283 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005283
Domain Number 1 Region: 30-87
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000106
Family TNF receptor-like 0.0000675
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005283   Gene: ENSTBEG00000006143   Transcript: ENSTBET00000006139
Sequence length 233
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5978:39180:43882:-1 gene:ENSTBEG00000006143 transcript:ENSTBET00000006139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLLALLVGIHPHGVIGLVPHLGDREKRDSQCPHGKYSHPRNNSICCTKCHKGTYLYDHCP
APDQVTDCRECENGTYTARENQLTQCFSCTICRKXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCQGSPQCMK
SCLPFSENVQGRQDADTTVLLPLVIILSLCLMLGPFVGILCRSRRWKPKLSSI
Download sequence
Identical sequences ENSTBEP00000005283 ENSTBEP00000005283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]