SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005312 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005312
Domain Number 1 Region: 436-687
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.67e-71
Family PDEase 0.00000373
Further Details:      
 
Domain Number 2 Region: 190-381
Classification Level Classification E-value
Superfamily GAF domain-like 5.23e-48
Family GAF domain 0.000029
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000005312
Domain Number - Region: 32-111
Classification Level Classification E-value
Superfamily GAF domain-like 0.000322
Family GAF domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005312   Gene: ENSTBEG00000006151   Transcript: ENSTBET00000006170
Sequence length 688
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1417:38974:273595:-1 gene:ENSTBEG00000006151 transcript:ENSTBET00000006170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESAPKEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNHLLLYELSSIIKIATKADGFALYF
LGECNNSLCVFSPPGIKEGKPQLIPAGPITQGTTISAYVAKSRKTLLVDDILGXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVATALAWASVAIHQV
QVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNK
ELYSDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVD
LYTGYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANM
YHRIRHSECIYRVTMEKLSYHSICTAEEWQGLMHSTLPARLCKEIEXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXFDLEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYSILQTSREL
FTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEG
HNIFSALSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQAGSLNLNNQSHXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDEMKKLGIQPIPMMDRDKKDEVPQGQL
GFYNAVAIPCYTTLTQILPPTEPLLKAC
Download sequence
Identical sequences ENSTBEP00000005312 ENSTBEP00000005312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]