SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005592 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005592
Domain Number 1 Region: 21-118
Classification Level Classification E-value
Superfamily Lysozyme-like 6.17e-32
Family C-type lysozyme 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005592   Gene: ENSTBEG00000006505   Transcript: ENSTBET00000006492
Sequence length 120
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4950:586086:589163:-1 gene:ENSTBEG00000006505 transcript:ENSTBET00000006492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKASVVLSLIGYLVVPSSASVLGRCTVAKMLHQGGLDYYEGYSLENWVCLAYFESKFNPT
AVYENSGYTGFGLFQIRDTEWCGHGKKRCHVSCSALLNPNLKETIKCVKEIVKGKDGMGA
Download sequence
Identical sequences ENSTBEP00000005592 ENSTBEP00000005592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]