SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005724 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005724
Domain Number 1 Region: 5-97
Classification Level Classification E-value
Superfamily WWE domain 3.3e-31
Family WWE domain 0.00083
Further Details:      
 
Domain Number 2 Region: 315-418
Classification Level Classification E-value
Superfamily RING/U-box 8.03e-19
Family RING finger domain, C3HC4 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005724   Gene: ENSTBEG00000006649   Transcript: ENSTBET00000006644
Sequence length 545
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5715:127443:200778:1 gene:ENSTBEG00000006649 transcript:ENSTBET00000006644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLRPVRRNYYDPSSAPGKGVVWEWENDNGSWTPYDMEVSITIQHAYEKQHPWIDLTSIGF
SYVIDFSTMGQINRQTQRQRRVRRRLDLIYPMVTGTLPKAQSWPVSPAAAASPPAPPCSC
PQCVLVMSVKAAVVNGSTGPLQPPTARKNVPSSGVVKLPAPPGSAAKPLDSTGTIRSPVK
PARQVIRRQASSTPAGATAGSPASPPGANGKTGRVALATLSRTNLQRLAIAQSRVLIASG
VPTVPVKNLNGSSPVNPALAGITGILMSAGLPVCLXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXTPEEVLKKYLQKVRHPPEEDCTICMERLTAPSGYKGPQPTVKPDLV
GKLSRCGHIYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPPGKMEYHLIPHSLPG
HPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKGRKVLKLLLVAWDRR
LIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNVLAELAAQGISEDST
TQEKD
Download sequence
Identical sequences ENSTBEP00000005724 ENSTBEP00000005724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]