SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005762 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005762
Domain Number 1 Region: 519-830
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.11e-85
Family PDEase 0.000000000161
Further Details:      
 
Domain Number 2 Region: 317-514
Classification Level Classification E-value
Superfamily GAF domain-like 1.41e-25
Family GAF domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000005762
Domain Number - Region: 237-266
Classification Level Classification E-value
Superfamily GAF domain-like 0.000267
Family GAF domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005762   Gene: ENSTBEG00000006664   Transcript: ENSTBET00000006684
Sequence length 848
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3013:121730:251698:-1 gene:ENSTBEG00000006664 transcript:ENSTBET00000006684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRAGPSSGQPQPQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVHTIPVCKE
GIRGHTETCSCPLQQSPRADSSAPGTPTRKISASEFDRPLRPIVVKDSEGTVSFLSDSEK
KEQMPLTPPRFDLDEGDQCSRLLELVKDISSHLDVTALCHKIFLHIHGLISADRXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPR
FNAEVDQITGYKTQSILCMPIKNHREEXXXXXXXXXXXXXXXXXXXXXXXXDFAAYLAFC
GIVLHNAQLYETSLLENRRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIF
IVDEDCSXXXXXXXXXXXXXXXXXXXXXXXERDANKINYMYAQYVKNTMEPLNIPDVSKD
RRFPWTKNTERVNPREKNRCCSALIRREKVCQLVNKMEENTGKVKPFNRNDEQFLEAFVI
FCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASAAEEETRELQSLAAAVVPSAQTLKIT
DFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKHEVLCRWILSVKKNYRKNVAYHNWRH
AFNTAQCMFAALKAGKIQNQLTDLEILALLIAALSHDLDHRGVNNSYIQXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXGNQILSGLSIEEYKTTLKIIKQAILATDLALYIKRRGEFFE
LIRKNQFDLEDPHQKELFLAMLMTACDLSAITKPWPIQQRIAELVATEFFDQGDRERKEL
NIEPTIPSMQVGFIDAICLQLYEALTHVSEDCFPLLDGCRKNRQKWQALAEQQEKTLING
ESSQAKRN
Download sequence
Identical sequences ENSTBEP00000005762 ENSTBEP00000005762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]