SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005849 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005849
Domain Number 1 Region: 2-127
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.03e-36
Family Dual specificity phosphatase-like 0.00000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005849   Gene: ENSTBEG00000006790   Transcript: ENSTBET00000006777
Sequence length 135
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2407:66547:74391:-1 gene:ENSTBEG00000006790 transcript:ENSTBET00000006777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREE
PGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPK
MRLRFRDTNGHCCVQ
Download sequence
Identical sequences ENSTBEP00000005849 ENSTBEP00000005849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]