SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000006198 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000006198
Domain Number 1 Region: 2-146
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.33e-44
Family Ankyrin repeat 0.00015
Further Details:      
 
Domain Number 2 Region: 200-243
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000314
Family SOCS box-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000006198   Gene: ENSTBEG00000007197   Transcript: ENSTBET00000007177
Sequence length 245
Comment pep:known_by_projection scaffold:TREESHREW:scaffold_8853:4480:7222:1 gene:ENSTBEG00000007197 transcript:ENSTBET00000007177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GADVNCTHGTLKPLHCACMVSDADCVELLLEKGAEVNALDGYNRTALHYAAEKDEACVEV
LLEYGANPNALDGNRDTPLHWAAFKNNAECVRALLESGASVNALDYNNDTPLSWAAMKGN
LESVSILLDYGAEVRVINLKGQTPISRLVALLVRGLGTEKEDSCFELLHRAVGHFELRKN
GTMPREVARDQQLCEKLTVLCSVPGTLKTLSRYAVRRSLGLQYLPDAVKGLPLPASLKEY
LLLIE
Download sequence
Identical sequences ENSTBEP00000006198 ENSTBEP00000006198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]