SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000006412 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000006412
Domain Number 1 Region: 92-196
Classification Level Classification E-value
Superfamily NTF2-like 3.14e-34
Family NTF2-like 0.0000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000006412   Gene: ENSTBEG00000007431   Transcript: ENSTBET00000007419
Sequence length 199
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_908:223646:229802:1 gene:ENSTBEG00000007431 transcript:ENSTBET00000007419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKSKKNWSRGDRRRYQGRGDYYREEPHTSHSWRGGRTREDAVTPPPLPVPAVSGSPMAT
SVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXALTRLYLDKATLIWNGNVVTGLDALNNFF
EMLPSSEFQINMLDCQPVHEQATQSQSTVLVVTSGTVKFDGNKQHFFNQNFLLTAQSSPN
STVWKIASDCFRFQDWSSS
Download sequence
Identical sequences ENSTBEP00000006412 ENSTBEP00000006412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]