SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000006417 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000006417
Domain Number 1 Region: 610-865
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-55
Family YWTD domain 0.00000572
Further Details:      
 
Domain Number 2 Region: 2-262
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-54
Family YWTD domain 0.00000161
Further Details:      
 
Domain Number 3 Region: 912-1170
Classification Level Classification E-value
Superfamily YWTD domain 6.67e-38
Family YWTD domain 0.0000657
Further Details:      
 
Domain Number 4 Region: 391-439,488-538
Classification Level Classification E-value
Superfamily YWTD domain 0.000000000222
Family YWTD domain 0.0018
Further Details:      
 
Domain Number 5 Region: 1301-1337
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000746
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1263-1299
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000458
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1223-1261
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 565-611
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000191
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 9 Region: 868-914
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000312
Family EGF-type module 0.024
Further Details:      
 
Domain Number 10 Region: 1180-1232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000936
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000006417
Domain Number - Region: 265-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.013
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000006417   Gene: ENSTBEG00000007403   Transcript: ENSTBET00000007424
Sequence length 1581
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4392:126218:221777:1 gene:ENSTBEG00000007403 transcript:ENSTBET00000007424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPLLLFANRRDVRLVDAGGVKLESTIVVSGLEDAAAVDFQFSKGAVYWTDVSEEAIKQTY
LNQTGAAVQNVVISGLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTSRKVLFWQDLD
QPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYW
ADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKR
KEILSALYSPMDIQVLSQERQPSHTQCEEDNGGCSHLCLLAREPFYACCPTGVQLQDNGR
TCKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWVARNLYWTDTGTDRIEVTRLNGTSRKILV
SEDLDEPRAIVLHPVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVK
ASRDVIIDQLPDLMGLKAVNVAKVVGTNPCADRNGGCSHLCFFTPRATRCGCPIGLELLS
DMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVS
LKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVL
VWRDLDNPRSLALDPTKGYIYWTEWGGKPKIVRAFMDGTNCMTLVDKVGRANDLTIDYAD
QRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTS
GRNRTLIQGQLDFVMDILVFHSSRQDGLNDCVHSNGQCGQLCLAIPDGHRCSCASHYTLD
PSSRNCSPPTTFLLFSQKGAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVD
GRQNIKRAKDDGTQAPFVLTSLSQSQNPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLN
GDAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTTGLIRP
VALVVDNTLGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPMGLTVLGKHLYWIDRQQ
QMIERVEKTTGDKRTRVQGRVAHLTGIHAVEEVSLEEFSAHPCARDNGGCSHICIAKGDG
TPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDEEG
CPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEADCDAVCLPNQFRCASGQCVLIKQQ
CDSFPDCIDGSDELMCEIAKPPSDDSPAHSSAVGPVIGIILSLFVMGGVYFVCQRVVCQR
YAGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGITCSKSMMSSVSLMGGRGGVPLYD
RNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNVEMFYPSNIPAAARPYRPYIIR
GMAPPTTPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSP
VTERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences ENSTBEP00000006417 ENSTBEP00000006417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]