SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000006473 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000006473
Domain Number 1 Region: 491-696
Classification Level Classification E-value
Superfamily SIS domain 6.07e-52
Family double-SIS domain 0.0000148
Further Details:      
 
Domain Number 2 Region: 1-209
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 7.46e-38
Family Class II glutamine amidotransferases 0.0000499
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000006473
Domain Number - Region: 334-363
Classification Level Classification E-value
Superfamily SIS domain 0.0356
Family double-SIS domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000006473   Gene: ENSTBEG00000007472   Transcript: ENSTBET00000007483
Sequence length 696
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5006:421463:475483:-1 gene:ENSTBEG00000007472 transcript:ENSTBET00000007483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAGVGFDGGNDKDWEANACKIQLIKKK
GKVKALDEEVHKQQDMDLDIEFDVHLGIAHTRWATHGEPNPVNSHPQRSDKNNEFIVIHN
GIITNYKDLKKFLESKGYDFESETDTETIAKLVKYMYDNRESQDTSFTTLVERVIQQLXX
XXXXXXXXXXXXXXXXXXXRGSPLLIGVRSEHKLSTDHIPILYRTARTHIGSKFTRWGSQ
GERGKDKKGSCNLSRVDSTTCLFPVEEKAVEYYFASDAXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNFSSFMQKEIFEQPESVVNTMRGRVN
FDDYTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDD
EIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDK
LMPVIMIIMRDHTYAKCQNAFQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQ
GILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences ENSTBEP00000006473 ENSTBEP00000006473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]