SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000007169 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000007169
Domain Number 1 Region: 150-424
Classification Level Classification E-value
Superfamily Caspase-like 3.14e-84
Family Caspase catalytic domain 0.000000000308
Further Details:      
 
Domain Number 2 Region: 7-98
Classification Level Classification E-value
Superfamily DEATH domain 8.48e-23
Family Caspase recruitment domain, CARD 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000007169   Gene: ENSTBEG00000008261   Transcript: ENSTBET00000008272
Sequence length 426
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5089:29457:40518:1 gene:ENSTBEG00000008261 transcript:ENSTBET00000008272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILGVCGMHPDHQETLKKNRVVLAKQLLPSELLEHLLEKDIITLEMRELIQAKVGSFSQNV
ELLNLLPKRGPQAFDAFCEALRETKQGHLEDLLLTTLSDLQHALPPLSCDYDLNLPFPVC
ESCPPHKQLRLSADAVEYSLDNGDPPCLQVKPCTPEFYQKHCQLAYRLQSRPRGLALVLS
NVHFTGEKDLEFRSGGDVDHSALVTLFKLLGYSVHVLHDQTAQEMQEKLQNFAQLPAHRV
TDSCIVALLSHGVEGGIYGVDGKLLQLQEVFRLFDNANCPNLQNKPKMFFIQACRGDETD
RGVDQQDGKNHARSPGCEESDASKEEMLRTRLPTRSDMICGYACLKGTAAMRNTKRGSWY
IQALTQVFSERACDMHVADMLVKVNALIKEREGYAPGTEFHRCKEMSEYCSTLCRHLYLF
PGHPPT
Download sequence
Identical sequences ENSTBEP00000007169 ENSTBEP00000007169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]